{"product_id":"proteintech-27213-1-ap","title":"Proteintech, 27213-1-AP, RHOA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHOA (27213-1-AP) by Proteintech is a Polyclonal antibody targeting RHOA in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27213-1-AP targets RHOA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRhoA is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of RhoA is associated with tumor cell proliferation and metastasis. RhoA signalling is critical to many cellular processes including migration, mechanotransduction, and is often disrupted in carcinogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25873 Product name: Recombinant human RHOA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-161 aa of BC005976 Sequence: NDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSA Predict reactive species\nFull Name: ras homolog gene family, member A\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC005976\nGene Symbol: RHOA\nGene ID (NCBI): 387\nRRID: AB_2880803\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61586\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869753626793,"sku":"27213-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27213-1-ap","provider":"Iright","version":"1.0","type":"link"}