{"product_id":"proteintech-27215-1-ap","title":"Proteintech, 27215-1-AP, BAF53B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAF53B (27215-1-AP) by Proteintech is a Polyclonal antibody targeting BAF53B in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n27215-1-AP targets BAF53B in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  rat brain tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAF53B, also named as ACTL6B, encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. BAF53b is unique among nucleosome remodeling complex subunits because it is neuron specific and is not found in any other nucleosome remodeling complex besides the nBAF complex(PMID: 23525042). BAF53B can be detected as about 47-53 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25745 Product name: Recombinant human ACTL6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-82 aa of BC020944 Sequence: TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM Predict reactive species\nFull Name: actin-like 6B\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 47-53 kDa\nGenBank Accession Number: BC020944\nGene Symbol: BAF53B\nGene ID (NCBI): 51412\nRRID: AB_2857952\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94805\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869641625769,"sku":"27215-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27215-1-ap","provider":"Iright","version":"1.0","type":"link"}