{"product_id":"proteintech-27224-1-ap","title":"Proteintech, 27224-1-AP, Integrin alpha-5\/CD49e Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin alpha-5\/CD49e (27224-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-5\/CD49e in WB, IHC, IP, ELISA applications with reactivity to human samples\n27224-1-AP targets Integrin alpha-5\/CD49e in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HAP1 cells,  HeLa cells,  human placenta tissue,  U2OS cells\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26098 Product name: Recombinant human ITGA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 874-995 aa of NM_002205 Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY Predict reactive species\nFull Name: integrin, alpha 5 (fibronectin receptor, alpha polypeptide)\nCalculated Molecular Weight: 115 kDa\nObserved Molecular Weight: 135-150 kDa\nGenBank Accession Number: NM_002205\nGene Symbol: Integrin alpha 5\nGene ID (NCBI): 3678\nRRID: AB_2880807\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08648\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869412806825,"sku":"27224-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27224-1-ap","provider":"Iright","version":"1.0","type":"link"}