{"product_id":"proteintech-27229-1-ap","title":"Proteintech, 27229-1-AP, ASXL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASXL2 (27229-1-AP) by Proteintech is a Polyclonal antibody targeting ASXL2 in WB, ELISA applications with reactivity to human samples\n27229-1-AP targets ASXL2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, Jurkat cells,  U2OS  cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASXL2 is an epigenetic regulator associated with various tumors including colorectal cancer, breast cancer, and myeloid leukemia. ASXL1, ASXL2 and ASXL3 are human homologs of Drosophila Asx (Additional sex combs) and function as epigenetic regulators through recruitment of Polycomb group repressor complexes (PRC) and Trithorax group activator complexes. ASXL proteins can interact with BAP1, NCOA1, EZH2, WTIP and nuclear receptors, which suggests diverse functions of ASXL family members in epigenetic and transcriptional regulation. (PMID: 30093396, PMID: 34692512)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24402 Product name: Recombinant human ASXL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 744-918 aa of BC042999 Sequence: LARDLIQAAQKQMAHAVRGKAIRSSPELFSSTVLPLPADSPTHQPLLLPPLQTPKLYGSPTQIGPSYRGMINVSTSSDMDHNSAVPGSQVSSNVGDVMSFSVTVTTIPASQAMNPSSHGQTIPVQAFSEENSIEGTPSKCYCRLKAMIMCKGCGAFCHDDCIGPSKLCVSCLVVR Predict reactive species\nFull Name: additional sex combs like 2 (Drosophila)\nCalculated Molecular Weight: 154 kDa\nObserved Molecular Weight: 154-230 kDa\nGenBank Accession Number: BC042999\nGene Symbol: ASXL2\nGene ID (NCBI): 55252\nRRID: AB_3669589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q76L83\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885082529961,"sku":"27229-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27229-1-ap","provider":"Iright","version":"1.0","type":"link"}