{"product_id":"proteintech-27239-1-ap","title":"Proteintech, 27239-1-AP, PELP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PELP1 (27239-1-AP) by Proteintech is a Polyclonal antibody targeting PELP1 in IF\/ICC, ELISA applications with reactivity to human samples\n27239-1-AP targets PELP1 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPELP1 was first identified as a 160 kDa protein in a screen for Src homology 2 (SH2) domain-binding proteins. PELP1 is overexpressed in 60-80% of breast tumors and plays important roles in both ER genomic and non-genomic signaling. In vivo, PELP1 subcellular localization is primarily nuclear in normal breast tissue, but it is localized to the cytoplasm in about 40% of invasive breast tumors. In the nucleus, PELP1 interacts with a number of transcription factors. The proto-oncogenic functions of PELP1 involve different cellular processes including epigenetic modifications leading to ER transactivation and breast cancer progression. Furthermore, PELP1 activates kinase cascades in the cytoplasm such as MAPK activation via c-Src and PI3K signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25729 Product name: Recombinant human PELP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 39-338 aa of BC069058 Sequence: ESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPV Predict reactive species\nFull Name: proline, glutamate and leucine rich protein 1\nCalculated Molecular Weight: 1130 aa, 120 kDa\nGenBank Accession Number: BC069058\nGene Symbol: PELP1\nGene ID (NCBI): 27043\nRRID: AB_2918120\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZL8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887756759209,"sku":"27239-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27239-1-ap","provider":"Iright","version":"1.0","type":"link"}