{"product_id":"proteintech-27248-1-ap","title":"Proteintech, 27248-1-AP, RICTOR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RICTOR (27248-1-AP) by Proteintech is a Polyclonal antibody targeting RICTOR in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27248-1-AP targets RICTOR in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, NIH\/3T3 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human lung cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25649 Product name: Recombinant human RICTOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC029608 Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGV Predict reactive species\nFull Name: rapamycin-insensitive companion of mTOR\nCalculated Molecular Weight: 192 kDa\nObserved Molecular Weight: 192 kDa\nGenBank Accession Number: BC029608\nGene Symbol: RICTOR\nGene ID (NCBI): 253260\nRRID: AB_2880817\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6R327\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868868464809,"sku":"27248-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27248-1-ap","provider":"Iright","version":"1.0","type":"link"}