{"product_id":"proteintech-27267-1-ap","title":"Proteintech, 27267-1-AP, TMEM26 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM26 (27267-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM26 in WB, ELISA applications with reactivity to human samples\n27267-1-AP targets TMEM26 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, HepG2 cells,  Jurkat cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:4000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Transmembrane protein 26 (TMEM26) gene encodes a protein containing multiple transmembrane fragments.  Immunostaining indicated elevated TMEM26 expression in ESCC tumors. Various ESCC cell lines showed a high TMEM26 expression, where its plasma membrane localization was confirmed. The RNAi depletion of TMEM26 in TMEM26-high ESCC cells suppressed EMT-related alterations, including invasion, migration, and marker gene expression. Conversely, TMEM26 overexpression in TMEM26-low ESCC cells promoted these EMT-related alterations. Interestingly, TMEM26 depletion or overexpression did not affect cell growth, indicating its specific involvement in the EMT process. The animal study demonstrated the contributive role of TMEM26 in metastatic ESCC. Mechanistically, TMEM26 promoted NF-κB signaling to accelerate EMT in ESCC cells. The plasma membrane presentation and TJ protein assembly were impaired by TMEM26, which was likely to be another mechanism for EMT regulation by TMEM26 in ESCC. Therefore, TMEM26 disrupted TJ formation and promoted NF-κB signaling during the EMT activation in ESCC (PMID: 37611445). TMEM26 shows features for chain, glycosylation, modified residue (large scale data).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24409 Product name: Recombinant human TMEM26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 84-188 aa of BC042872 Sequence: ELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTSRADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLMFVGTAADI Predict reactive species\nFull Name: transmembrane protein 26\nCalculated Molecular Weight: 368 aa, 42 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC042872\nGene Symbol: TMEM26\nGene ID (NCBI): 219623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZUK4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887832223913,"sku":"27267-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27267-1-ap","provider":"Iright","version":"1.0","type":"link"}