{"product_id":"proteintech-27272-1-ap","title":"Proteintech, 27272-1-AP, SHANK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHANK2 (27272-1-AP) by Proteintech is a Polyclonal antibody targeting SHANK2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n27272-1-AP targets SHANK2 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH3 and multiple ankyrin repeat domains protein 2 (SHANK2) is also named as CORTBP1, KIAA1022, PROSAP1. SHANK2 code a scaffolding protein located at the postsynaptic membrane of glutamatergic neurons (PMID: 32987185). SHANK2 encodes for a postsynaptic scaffolding protein at glutamatergic synapses in the brain, essential for proper synapse formation, development and plasticity (PMID: 11283303, PMID: 12065602). As SHANK2 directly interacts with IRSp53 (insulin receptor substrate p53), it may be involved in insulin signaling in the brain, making this pathway susceptible to SHANK2 mutations (PMID: 33483523). In the SFARI gene database, SHANK2 is categorized as a high confidence autism risk gene. In addition, SHANK2 has been linked to the pathology of neuropsychiatric (schizophrenia, bipolar disorder) and neurodegenerative disorders (PMID: 33483523).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26101 Product name: Recombinant human SHANK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-490 aa of NM_012309 Sequence: VDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP Predict reactive species\nFull Name: SH3 and multiple ankyrin repeat domains 2\nCalculated Molecular Weight: 159 kDa\nObserved Molecular Weight: 158-200 kDa\nGenBank Accession Number: NM_012309\nGene Symbol: SHANK2\nGene ID (NCBI): 22941\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPX8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887800373417,"sku":"27272-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27272-1-ap","provider":"Iright","version":"1.0","type":"link"}