{"product_id":"proteintech-27284-1-ap","title":"Proteintech, 27284-1-AP, JAK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JAK1 (27284-1-AP) by Proteintech is a Polyclonal antibody targeting JAK1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27284-1-AP targets JAK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, J774A.1 cells,  RAW 264.7 cells,  mouse lung tissue,  rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJanus kinase 1(JAK1), is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. JAK1 is essential for signaling for certain type I and type II cytokines. JAK1 plays a critical role in initiating responses to multiple major cytokine receptor families. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25579 Product name: Recombinant human JAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1080-1151 aa of BC132729 Sequence: SDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEA Predict reactive species\nFull Name: Janus kinase 1 (a protein tyrosine kinase)\nCalculated Molecular Weight: 1154 aa, 133 kDa\nObserved Molecular Weight: 125-133 kDa\nGenBank Accession Number: BC132729\nGene Symbol: JAK1\nGene ID (NCBI): 3716\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23458\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869699625129,"sku":"27284-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27284-1-ap","provider":"Iright","version":"1.0","type":"link"}