{"product_id":"proteintech-27294-1-ap","title":"Proteintech, 27294-1-AP, FBXO31 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO31 (27294-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO31 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27294-1-AP targets FBXO31 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: mouse uterus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO31, also known as F-box protein 31, is a substrate recognition protein of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex. It plays a crucial role in mediating the ubiquitination and subsequent degradation of target proteins through the ubiquitin-proteasome system. In pancreatic cancer, FBXO31 is upregulated and promotes cancer progression by targeting proteins like SIRT2 for degradation (PMID: 38216561). In endometrial cancer, FBXO31 acts as a tumor suppressor by regulating the ubiquitination of OGT (O-GlcNAc transferase), which affects cellular O-GlcNAcylation levels (PMID: 39894887). FBXO31 Is a reader of C-terminal amides, which ubiquitylates CTAPs for subsequent proteasomal degradation. A dominant de novo D334N mutation in FBXO31 alters FBXO31 substrate recognition and CTAP clearance, causing some important proteins to be degraded and clinical intellectual impairment or diplegic spastic cerebral (PMID: 39880951).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24867 Product name: Recombinant human FBXO31 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-178 aa of BC012748 Sequence: MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRH Predict reactive species\nFull Name: F-box protein 31\nObserved Molecular Weight: 49 kDa, 60-70 kDa\nGenBank Accession Number: BC012748\nGene Symbol: FBXO31\nGene ID (NCBI): 79791\nRRID: AB_2880833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5XUX0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869541093545,"sku":"27294-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27294-1-ap","provider":"Iright","version":"1.0","type":"link"}