{"product_id":"proteintech-27331-1-ap","title":"Proteintech, 27331-1-AP, Inhibin alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Inhibin alpha (27331-1-AP) by Proteintech is a Polyclonal antibody targeting Inhibin alpha in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27331-1-AP targets Inhibin alpha in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue, mouse testis tissue,  rat ovary tissue\nPositive IHC detected in: mouse ovary tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInhibin, a heterodimeric member of the TGF family, consists of an alpha (α) subunit (coded by INHA) and a beta (β) subunit, which combine to produce either inhibin A (αβA) or inhibin B (αβB). Inhibin complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25999 Product name: Recombinant human INHA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-366 aa of BC006391 Sequence: STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI Predict reactive species\nFull Name: inhibin, alpha\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC006391\nGene Symbol: Inhibin alpha\nGene ID (NCBI): 3623\nRRID: AB_3085946\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869698511017,"sku":"27331-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27331-1-ap","provider":"Iright","version":"1.0","type":"link"}