{"product_id":"proteintech-27348-1-ap","title":"Proteintech, 27348-1-AP, IL-1R1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-1R1 (27348-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1R1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27348-1-AP targets IL-1R1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MOLT-4 cells,  Raji cells,  EL-4-B5 cells,  NIH\/3T3 cells,  mouse liver tissue\nPositive IHC detected in: mouse spleen tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-1R1 (IL-1 receptor type 1, also known as p80, IL-1R-alpha or CD121a) is a 80 kDa transmembrane glycoprotein and a member of the interleukin-1 receptor family (PMID: 35163653; 29248002). It is a receptor for IL-1α, IL-1β, and interleukin-1 receptor antagonist (IL-1Ra). IL-1α and IL-1β interact with the extracellular domain of IL-1R1, triggering the recruitment of an accessory receptor, the IL-1RAcP, resulting in a functional receptor complex that initiates IL-1R1 signaling cascades (PMID: 35163653). IL-1Ra competes with active IL-1 and blocks binding to their common activating receptor IL-1R1 and, thus, inhibits IL-1 signaling (PMID: 35332327; 11641511). It has been reported that IL-1R1 may also bind IL-38 (PMID: 29248002). IL-1R1 expression has been found in many cell types including T cells, macrophages, neutrophils, eosinophils, basophils, mast cells, fibroblasts, and endothelial cells. IL-1R1 can be released from the cell surface following proteolytic cleavage, generating a soluble form of 55-60 kDa (PMID: 17324958).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25998 Product name: Recombinant human IL-1R1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-336 aa of BC075063 Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK Predict reactive species\nFull Name: interleukin 1 receptor, type I\nCalculated Molecular Weight: 569 aa, 65 kDa\nObserved Molecular Weight: 80 kDa, 60 kDa\nGenBank Accession Number: BC075063\nGene Symbol: IL1R1\nGene ID (NCBI): 3554\nRRID: AB_3085949\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14778\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869467005097,"sku":"27348-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27348-1-ap","provider":"Iright","version":"1.0","type":"link"}