{"product_id":"proteintech-27349-1-ap","title":"Proteintech, 27349-1-AP, RAB33B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB33B (27349-1-AP) by Proteintech is a Polyclonal antibody targeting RAB33B in WB, IHC, ELISA applications with reactivity to human samples\n27349-1-AP targets RAB33B in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  U-87 MG cells,  HEK-293 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB33B is a small GTP-binding protein of the Rab GTPase family, whose members function in vesicle transport during protein secretion and endocytosis. Rab GTPases are active, membrane-associated proteins that recruit effector proteins in the GTP-bound state and inactive cytosolic proteins when in a GDP-bound state. RAB33B is ubiquitously expressed and has been implicated in Golgi to endoplasmic reticulum cycling of Golgi enzymes. In addition, RAB33B regulates Golgi homeostasis and coordinates intra-Golgi retrograde trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24181 Product name: Recombinant human RAB33B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-229 aa of BC036064 Sequence: IGDSNVGKTCLTYRFCAGRFPDHTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC Predict reactive species\nFull Name: RAB33B, member RAS oncogene family\nCalculated Molecular Weight: 229 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC036064\nGene Symbol: RAB33B\nGene ID (NCBI): 83452\nRRID: AB_2880851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H082\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869747826857,"sku":"27349-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27349-1-ap","provider":"Iright","version":"1.0","type":"link"}