{"product_id":"proteintech-27355-1-ap","title":"Proteintech, 27355-1-AP, AP50 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP50 (27355-1-AP) by Proteintech is a Polyclonal antibody targeting AP50 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n27355-1-AP targets AP50 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HepG2 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26059 Product name: Recombinant human AP50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC013796 Sequence: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYE Predict reactive species\nFull Name: adaptor-related protein complex 2, mu 1 subunit\nCalculated Molecular Weight: 433 aa, 49 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC013796\nGene Symbol: AP50\nGene ID (NCBI): 1173\nRRID: AB_2880853\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CW1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868976238761,"sku":"27355-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27355-1-ap","provider":"Iright","version":"1.0","type":"link"}