{"product_id":"proteintech-27377-1-ap","title":"Proteintech, 27377-1-AP, IL-2RG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-2RG (27377-1-AP) by Proteintech is a Polyclonal antibody targeting IL-2RG in WB, ELISA applications with reactivity to human samples\n27377-1-AP targets IL-2RG in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe interleukin-2 receptor (IL-2R) is a heterotrimeric receptor consisting of three subunits, alpha (IL-2RA), beta (IL-2RB), and gamma (IL-2RG). IL-2RG, also known as CD132, is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in the gene of IL-2RG cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26388 Product name: Recombinant human IL-2RG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-262 aa of BC014972 Sequence: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA Predict reactive species\nFull Name: interleukin 2 receptor, gamma (severe combined immunodeficiency)\nCalculated Molecular Weight: 369 aa, 42 kDa\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC014972\nGene Symbol: IL2RG\nGene ID (NCBI): 3561\nRRID: AB_2880857\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31785\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887682539689,"sku":"27377-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27377-1-ap","provider":"Iright","version":"1.0","type":"link"}