{"product_id":"proteintech-27387-1-ap","title":"Proteintech, 27387-1-AP, ABI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABI1 (27387-1-AP) by Proteintech is a Polyclonal antibody targeting ABI1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27387-1-AP targets ABI1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, C2C12 cells,  multi cells,  HEK-293T cells,  HepG2 cells,  HEK 293 cells,  Jurkat cells,  mouse cerebellum tissue,  rat cerebellum tissue\nPositive IHC detected in: mouse skin tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26537 Product name: Recombinant human ABI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-379 aa of BC024254 Sequence: TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP Predict reactive species\nFull Name: abl-interactor 1\nCalculated Molecular Weight: 507 aa, 55 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC024254\nGene Symbol: ABI1\nGene ID (NCBI): 10006\nRRID: AB_2880860\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZP0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869441904809,"sku":"27387-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27387-1-ap","provider":"Iright","version":"1.0","type":"link"}