{"product_id":"proteintech-27392-1-ap","title":"Proteintech, 27392-1-AP, OTULIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OTULIN (27392-1-AP) by Proteintech is a Polyclonal antibody targeting OTULIN in WB, ELISA applications with reactivity to human samples\n27392-1-AP targets OTULIN in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLinear ubiquitination is negatively regulated by OTULIN (OTU deubiquitinase with linear linkage specificity, also known as Fam105b or Gumby), a deubiquitinase specifically catalysing the degradation of linear ubiquitin chains. OUb signalling is antagonised by deubiquitinases (DUBs), which cleave the polyUb signal from substrates to terminate signalling. OTU DUB with linear linkage specificity (OTULIN) and CYLD are the two main DUBs that regulate M1-polyUb signalling. OTULIN exclusively cleaves M1 linkages, whereas CYLD cleaves both M1 and K63 linkages. OTULIN binds directly to the LUBAC subunit HOIP and regulates LUBAC signalling, autoubiquitination, and stability.(PMID: 34625557, PMID: 32231246)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22302 Product name: Recombinant human FAM105B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-214 aa of BC007706 Sequence: MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL Predict reactive species\nFull Name: family with sequence similarity 105, member B\nCalculated Molecular Weight: 352 aa, 40 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC007706\nGene Symbol: FAM105B\nGene ID (NCBI): 90268\nRRID: AB_3085952\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BN8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887747911849,"sku":"27392-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27392-1-ap","provider":"Iright","version":"1.0","type":"link"}