{"product_id":"proteintech-27405-1-ap","title":"Proteintech, 27405-1-AP, RanGAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RanGAP1 (27405-1-AP) by Proteintech is a Polyclonal antibody targeting RanGAP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27405-1-AP targets RanGAP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  Neuro-2a cells,  SKOV-3 cells,  NIH\/3T3 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRanGAP1 is a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO) targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC) where it forms a complex with RanBP2 and Ubc9. Phosphorylation of RanGAP1 occurs in a cell-cycle-dependent manner and may play a role in regulating RanGAP1 catalytic activity. We got 64 kDa (cytoplasmic Ran GAP1) and 82 kDa (SUMO-1 modified Ran GAP1) in western blotting.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26128 Product name: Recombinant human RANGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-220 aa of BC014044 Sequence: ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI Predict reactive species\nFull Name: Ran GTPase activating protein 1\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 64 kDa, 82 kDa\nGenBank Accession Number: BC014044\nGene Symbol: RANGAP1\nGene ID (NCBI): 5905\nRRID: AB_2880863\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46060\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869580382377,"sku":"27405-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27405-1-ap","provider":"Iright","version":"1.0","type":"link"}