{"product_id":"proteintech-27449-1-ap","title":"Proteintech, 27449-1-AP, SELENBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SELENBP1 (27449-1-AP) by Proteintech is a Polyclonal antibody targeting SELENBP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27449-1-AP targets SELENBP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse liver tissue,  L02 cells,  MCF-7 cells\nPositive IHC detected in: human liver cancer tissue, human colon tissue,  rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSELENBP1 (selenium binding protein 1,SBP1), also known as LPSB or SP56, is a 472 amino acid peripheral membrane protein that binds selenium covalently. Selenium, an essential trace element, has been shown to have an anti-cancer effect. Many reports have described a relationship between insufficient selenium intake and increased risk of cancer. Moreover, the expression of SELENBP1 has been shown to be decreased in several tumors including cancers of the prostate, lungs, colon, and ovary (PMID: 21143902, 20332323, 18272210). SELENBP1 has four isoforms with the molecular mass of 56kD, 52kD and 45kD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24453 Product name: Recombinant human SELENBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-472 aa of BC009084 Sequence: VIEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI Predict reactive species\nFull Name: selenium binding protein 1\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC009084\nGene Symbol: SELENBP1\nGene ID (NCBI): 8991\nRRID: AB_2880872\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13228\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887795982505,"sku":"27449-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27449-1-ap","provider":"Iright","version":"1.0","type":"link"}