{"product_id":"proteintech-27461-1-ap","title":"Proteintech, 27461-1-AP, HSD17B12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSD17B12 (27461-1-AP) by Proteintech is a Polyclonal antibody targeting HSD17B12 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27461-1-AP targets HSD17B12 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HCT 116 cells,  HEK-293 cells,  HT-29 cells,  U-251 cells\nPositive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHydroxysteroid 17-beta dehydrogenase 12 (HSD17B12, also known as KAR and SDR12C1) is a key enzyme of steroid metabolism pathway19 and is the human homolog of the yeast 3-ketoacyl-CoA reductase that catalyzes the second reaction in each VLCFA elongation cycle (PMID: 16166196; 12482854). It also acts as a drug-metabolizing enzyme (PMID: 36724833). HSD17B12 deficiency in embryonic stem cells reduced the production of arachidonic acid, a precursor of prostaglandins (PMID: 20130115).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26540 Product name: Recombinant human HSD17B12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-271 aa of BC012043 Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG Predict reactive species\nFull Name: hydroxysteroid (17-beta) dehydrogenase 12\nCalculated Molecular Weight: 312 aa, 34 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012043\nGene Symbol: HSD17B12\nGene ID (NCBI): 51144\nRRID: AB_3669604\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53GQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887671562409,"sku":"27461-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27461-1-ap","provider":"Iright","version":"1.0","type":"link"}