{"product_id":"proteintech-27465-1-ap","title":"Proteintech, 27465-1-AP, HMGB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HMGB3 (27465-1-AP) by Proteintech is a Polyclonal antibody targeting HMGB3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27465-1-AP targets HMGB3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, MCF-7 cells,  SGC-7901 cells,  human placenta tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMGB3, also named HMG2A and HMG4, belongs to the HMGB family. HMGB3 binds to nucleosomes in a sequence-independent manner and participates in DNA repair, replication, transcription, and recombination. HMGB3 is highly expressed in stem cells and cancer cells and is rarely transactivated in normal adult tissues, making it a promising therapeutic target. Overexpressed HMGB3 is closely related to tumor occurrence and reduced survival in cervical cancer, non-small-cell lung cancer, breast cancer, bladder cancer, hepatocellular carcnoma, colorectal cancer, gastric cancer, and leukemia (PMID: 35332131).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26361 Product name: Recombinant human HMGB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC070482 Sequence: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLF Predict reactive species\nFull Name: high-mobility group box 3\nCalculated Molecular Weight: 200 aa, 23 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC070482\nGene Symbol: HMGB3\nGene ID (NCBI): 3149\nRRID: AB_2880878\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15347\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955594921,"sku":"27465-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27465-1-ap","provider":"Iright","version":"1.0","type":"link"}