{"product_id":"proteintech-27467-1-ap","title":"Proteintech, 27467-1-AP, ATG4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG4A (27467-1-AP) by Proteintech is a Polyclonal antibody targeting ATG4A in WB, IHC, ELISA applications with reactivity to human samples\n27467-1-AP targets ATG4A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, MKN-45 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1500\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATG4, a member of the cysteine protease family, plays an important role in autophagy induction. ATG4 enzymes cleave the C-terminal amino acid of ATG8 family proteins to reveal a C-terminal glycine that is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes. ATG4A, which may be a target for cancer prevention and intervention, has been reported to be related to breast tumorigenesis, lung cancer, ovarian cancer, cervical cancer and gastric cancer. (PMID: 27276686, 29435029, 28636635)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26497 Product name: Recombinant human ATG4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-247 aa of BC061696 Sequence: DEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKEC Predict reactive species\nFull Name: ATG4 autophagy related 4 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC061696\nGene Symbol: ATG4A\nGene ID (NCBI): 115201\nRRID: AB_2880879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WYN0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869640413353,"sku":"27467-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27467-1-ap","provider":"Iright","version":"1.0","type":"link"}