{"product_id":"proteintech-27477-1-ap","title":"Proteintech, 27477-1-AP, Kininogen 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Kininogen 1 (27477-1-AP) by Proteintech is a Polyclonal antibody targeting Kininogen 1 in WB, IHC, ELISA applications with reactivity to human samples\n27477-1-AP targets Kininogen 1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKininogens are inhibitors of thiol proteases. Kininogen 1 plays important role in Kinin-kallikrein system. This gene is translated into High-molecular weight kininogen (HMWK) and low-molecular weight kininogen (LMWK) after alternative splicing. HMWK is produced by the liver together with prekallikrein. It acts mainly as a cofactor on coagulation and inflammation, and has no intrinsic catalytic activity. LMWK is produced locally by numerous tissues, and secreted together with tissue kallikrein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26467 Product name: Recombinant human KNG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-200 aa of BC060039 Sequence: ESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRMTYS Predict reactive species\nFull Name: kininogen 1\nCalculated Molecular Weight: 644 aa, 72 kDa\nObserved Molecular Weight: 70-72 kDa\nGenBank Accession Number: BC060039\nGene Symbol: Kininogen 1\nGene ID (NCBI): 3827\nRRID: AB_2880882\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01042\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696498857,"sku":"27477-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27477-1-ap","provider":"Iright","version":"1.0","type":"link"}