{"product_id":"proteintech-27488-1-ap","title":"Proteintech, 27488-1-AP, NDNL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDNL2 (27488-1-AP) by Proteintech is a Polyclonal antibody targeting NDNL2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27488-1-AP targets NDNL2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  HeLa cells,  human placenta tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDNL2 (also known as NSMCE3 or MAGEG1) is a part of the SMC5-6 protein complex that is essential for DNA damage response and chromosome segregation (PMID: 18086888; 27427983). The gene of human NDNL2 maps to chromosome 15q13.1. Northern blot analysis detected expression of a 1.9-kb transcript in all human tissues tested, with highest expression in testis  (PMID: 11782285). Missense mutations in NSMCE3 have been associated with an autosomal recessive chromosome breakage syndrome that leads to defective T and B cell function and acute respiratory distress syndrome in early childhood (PMID: 27427983).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26663 Product name: Recombinant human NDNL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC053999 Sequence: MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS Predict reactive species\nFull Name: necdin-like 2\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC053999\nGene Symbol: NDNL2\nGene ID (NCBI): 56160\nRRID: AB_2880885\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96MG7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869716697257,"sku":"27488-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27488-1-ap","provider":"Iright","version":"1.0","type":"link"}