{"product_id":"proteintech-27489-1-ap","title":"Proteintech, 27489-1-AP, TMX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMX1 (27489-1-AP) by Proteintech is a Polyclonal antibody targeting TMX1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27489-1-AP targets TMX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse brain tissue,  HeLa cells,  Jurkat cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMX1, one of the few transmembrane members of the family, is the first vascular thiol isomerase with antithrombotic function. It forms functional complexes with the ER lectin calnexin and preferentially intervenes during maturation of cysteine-containing, membrane-associated proteins while ignoring the same cysteine-containing ectodomains if not anchored at the ER membrane. As such, TMX1 is the first example of a topology-specific client protein redox catalyst in living cells(PMID: 30655304). Covalent modification with AMS increases the molecular mass of originally oxidized species by ~0.5 kDa per thiol group, which allows enhanced separation from the reduced form in electrophoresis(PMID: 29123984). TMX1 has 2 bands produces by redox with the MW of 30-32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26595 Product name: Recombinant human TMX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 202-280 aa of BC036460 Sequence: VADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS Predict reactive species\nFull Name: thioredoxin-related transmembrane protein 1\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC036460\nGene Symbol: TMX1\nGene ID (NCBI): 81542\nRRID: AB_2880886\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3N1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868974764201,"sku":"27489-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27489-1-ap","provider":"Iright","version":"1.0","type":"link"}