{"product_id":"proteintech-27490-1-ap","title":"Proteintech, 27490-1-AP, PDXP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDXP (27490-1-AP) by Proteintech is a Polyclonal antibody targeting PDXP in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n27490-1-AP targets PDXP in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Neuro-2a cells,  mouse brain tissue\nPositive IHC detected in: human liver tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDXP, also named CIN, belongs to the HAD-like hydrolase superfamily. As a pyridoxal phosphate (PLP) phosphatase, PDXP can catalyzes the dephosphorylation of pyridoxine 5'-phosphate (PNP) and pyridoxamine 5'-phosphate (PMP), with order of substrate preference PLP \u0026gt; PNP \u0026gt; PMP and therefore plays a role in vitamin B6 metabolism. PDXP is highly expressed in all the regions of central nerve system except the spinal cord. PDXP is also expressed at high level in liver and testis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26592 Product name: Recombinant human PDXP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-230 aa of BC064922 Sequence: GEGLRAELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDP Predict reactive species\nFull Name: pyridoxal (pyridoxine, vitamin B6) phosphatase\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC064922\nGene Symbol: PDXP\nGene ID (NCBI): 57026\nRRID: AB_2880887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96GD0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869726036137,"sku":"27490-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27490-1-ap","provider":"Iright","version":"1.0","type":"link"}