{"product_id":"proteintech-27494-1-ap","title":"Proteintech, 27494-1-AP, GTF3C2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GTF3C2 (27494-1-AP) by Proteintech is a Polyclonal antibody targeting GTF3C2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27494-1-AP targets GTF3C2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, A549 cells,  HeLa cells,  HepG2 cells,  MCF-7 cells,  PC-3 cells\nPositive IHC detected in: human thyroid cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGTF3C2, also named as KIAA0011, is a 911 amino acid protein, which localizes in the nucleus. GTF3C2 is required for RNA polymerase III-mediated transcription. GTF3C2 is a component of TFIIIC that initiates transcription complex assembly on tRNA and is required for transcription of 5S rRNA and other stable nuclear and cytoplasmic RNAs. GTF3C2 may play a direct role in stabilizing interactions of TFIIIC2 with TFIIIC1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26666 Product name: Recombinant human GTF3C2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 59-188 aa of BC020981 Sequence: GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA Predict reactive species\nFull Name: general transcription factor IIIC, polypeptide 2, beta 110kDa\nCalculated Molecular Weight: 101 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC020981\nGene Symbol: GTF3C2\nGene ID (NCBI): 2976\nRRID: AB_2880889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUA4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869690843305,"sku":"27494-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27494-1-ap","provider":"Iright","version":"1.0","type":"link"}