{"product_id":"proteintech-27498-1-ap","title":"Proteintech, 27498-1-AP, CLUL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLUL1 (27498-1-AP) by Proteintech is a Polyclonal antibody targeting CLUL1 in WB, ELISA applications with reactivity to human samples\n27498-1-AP targets CLUL1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: ARPE-19 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClusterin-like protein 1 (CLUL1) functions as a molecular chaperone, protecting stressed proteins, and is upregulated in various neurodegenerative conditions, suggesting a role in defense against neuronal damage (PMID: 17148042). It is specifically expressed in cone photoreceptor cells and is regulated by the cone-rod homeobox (CRX) (PMID: 14507903). Mutations of CLUL1 were investigated in the context of age-related macular degeneration (AMD), a leading cause of blindness in the elderly (PMID: 17148042).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26570 Product name: Recombinant human CLUL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-124 aa of BC025381 Sequence: APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNC Predict reactive species\nFull Name: clusterin-like 1 (retinal)\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC025381\nGene Symbol: CLUL1\nGene ID (NCBI): 27098\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15846\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886644547753,"sku":"27498-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27498-1-ap","provider":"Iright","version":"1.0","type":"link"}