{"product_id":"proteintech-27501-1-ap","title":"Proteintech, 27501-1-AP, MOCS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOCS3 (27501-1-AP) by Proteintech is a Polyclonal antibody targeting MOCS3 in WB, IHC, ELISA applications with reactivity to Human samples\n27501-1-AP targets MOCS3 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells\nPositive IHC detected in: human liver cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMOCS3, also named as molybdenum cofactor synthesis 3 and UBA4. The human MOCS3 protein contains an N-terminal domain similar to the Escherichia coli MoeB protein and a C-terminal segment displaying similarities to the sulfurtransferase rhodanese. MOCS3 is proposed to catalyze both the adenylation and the subsequent generation of a thiocarboxylate group at the C-terminus of the smaller subunit of molybdopterin (MPT) synthase during Moco biosynthesis in humans (PMID: 15910006). MOCS3 has a calculated molecular weight of 50 kDa and can be detected another band of 65 kDa due to urmylation (PMID: 21209336).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26596 Product name: Recombinant human MOCS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 279-404 aa of BC015939 Sequence: DALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGA Predict reactive species\nFull Name: molybdenum cofactor synthesis 3\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50 kDa, 65 kDa\nGenBank Accession Number: BC015939\nGene Symbol: MOCS3\nGene ID (NCBI): 27304\nRRID: AB_2880892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95396\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887721861289,"sku":"27501-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27501-1-ap","provider":"Iright","version":"1.0","type":"link"}