{"product_id":"proteintech-27506-1-ap","title":"Proteintech, 27506-1-AP, IFN-beta Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFN-beta (27506-1-AP) by Proteintech is a Polyclonal antibody targeting IFN-beta in WB, IF\/ICC, ELISA applications with reactivity to human samples\n27506-1-AP targets IFN-beta in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\nPositive IF\/ICC detected in: HepG2 cells, L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterferon-beta (IFN-β) is a type I interferon, which is a group of signaling proteins made and released by host cells in response to the presence of several viruses, including double-stranded RNA produced by many viruses. IFN-β is a single protein species and is molecularly related to IFN-α subtypes, although it is antigenically distinct from them. It is mainly produced by fibroblasts and plays a crucial role in the innate immune response against viruses. IFN-β can inhibit viral replication by interfering with the virus's RNA or DNA, thus suppressing viral growth.  It also enhances the cytotoxic activity of natural killer (NK) cells and promotes the expression of major histocompatibility complex (MHC) class I molecules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26326 Product name: Recombinant human IFNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-187 aa of BC069314 Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN Predict reactive species\nFull Name: IFN beta\nCalculated Molecular Weight: 187 aa, 22 kDa\nGenBank Accession Number: BC069314\nGene Symbol: IFN beta1\nGene ID (NCBI): 3456\nRRID: AB_2880893\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01574\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879179945,"sku":"27506-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27506-1-ap","provider":"Iright","version":"1.0","type":"link"}