{"product_id":"proteintech-27516-1-ap","title":"Proteintech, 27516-1-AP, CD100 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD100 (27516-1-AP) by Proteintech is a Polyclonal antibody targeting CD100 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27516-1-AP targets CD100 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, HeLa cells\nPositive IHC detected in: human tonsillitis tissue, human colon tissue,  human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD100 (also known as SEMA4D), a 150 kDa homodimer, belongs to the family of immune semaphorins, and CD100 is abundantly expressed on resting T cells, NK cells, and antigen-presenting cells. As a transmembrane glycoprotein, it is digested to its soluble form, sCD100, by specific matrix metalloproteinases. CD100 has been reported that the expression levels of CD100, and one of its receptors, plexin-B1 (PLXNB1), are increased in head and neck, prostate, colon, breast, and lung cancers, and the interaction between them provides oncogenic signaling essential for tumor growth and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26461 Product name: Recombinant human CD100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 756-862 aa of BC054500 Sequence: YKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD Predict reactive species\nFull Name: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D\nCalculated Molecular Weight: 96 kDa\nObserved Molecular Weight: 96 kDa\nGenBank Accession Number: BC054500\nGene Symbol: SEMA4D\/CD100\nGene ID (NCBI): 10507\nRRID: AB_2880896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92854\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869652275369,"sku":"27516-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27516-1-ap","provider":"Iright","version":"1.0","type":"link"}