{"product_id":"proteintech-27519-1-ap","title":"Proteintech, 27519-1-AP, CD48 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD48 (27519-1-AP) by Proteintech is a Polyclonal antibody targeting CD48 in WB, IHC, ELISA applications with reactivity to human samples\n27519-1-AP targets CD48 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells,  Ramos cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignaling lymphocytic activation molecule family 2 (SLAMF2, CD48) is an adhesion and costimulatory molecule expressed constitutively on most hematopoietic cells, particularly in antigen-presenting cells (APC). CD48 is expressed on all the hematopoietic cells, both in humans and mice, except for murine neutrophils and long-term HSC. CD48 exists as both a membrane-bound (mCD48) and a soluble (sCD48) form. CD48 can activate T cells, antigen-presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high-affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD48 expression is increased in autoimmunity and allergy diseases, and anti-CD48 monoclonal antibodies have been shown to attenuate experimental autoimmune encephalomyelitis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26536 Product name: Recombinant human CD48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-220 aa of BC016182 Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS Predict reactive species\nFull Name: CD48 molecule\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 38-45 kDa\nGenBank Accession Number: BC016182\nGene Symbol: CD48\nGene ID (NCBI): 962\nRRID: AB_2880897\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09326\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886269255849,"sku":"27519-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27519-1-ap","provider":"Iright","version":"1.0","type":"link"}