{"product_id":"proteintech-27558-1-ap","title":"Proteintech, 27558-1-AP, Alpha Taxilin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha Taxilin (27558-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha Taxilin in WB, IHC, ELISA applications with reactivity to human samples\n27558-1-AP targets Alpha Taxilin in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha-taxilin is a member of the taxilin family which consist of at least three members: alpha-, beta- and gamma-taxilins. Alpha-taxilin was identified as a novel binding partner of the syntaxin family, which is involved in intracellular vesicle traffic. Alpha-taxilin is ubiquitously expressed. It plays an essential role for release of HBV-DNA containing particles. Alpha-taxilin encompasses 546 aa and has a calculated molecular weight of 62 kDa. It migrates on SDS-PAGE with an apparent molecular weight of 75 kDa. (PMID: 12558796; 23816704)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23001 Product name: Recombinant human TXLNA protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 477-546 aa of BC103823 Sequence: ERNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA Predict reactive species\nFull Name: taxilin alpha\nCalculated Molecular Weight: 546 aa, 62 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC103823\nGene Symbol: Alpha Taxilin\nGene ID (NCBI): 200081\nRRID: AB_2880907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P40222\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869634678953,"sku":"27558-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27558-1-ap","provider":"Iright","version":"1.0","type":"link"}