{"product_id":"proteintech-27566-1-ap","title":"Proteintech, 27566-1-AP, TAB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAB1 (27566-1-AP) by Proteintech is a Polyclonal antibody targeting TAB1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27566-1-AP targets TAB1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HEK-293T cells,  NIH\/3T3 cells,  HCT 116 cells,  HeLa cells,  K-562 cells\nPositive IHC detected in: human colon cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (TAB1) is also named TAK1-binding protein 1 and MAP3K7IP1. TAB1 is constitutively associated with the composition N-terminal kinase domain of TAK1 and can be activated by pro-inflammatory cytokines (TNFα and IL-1β) and toll-like receptor ligands (PMID: 38072991). TAB1 is a scaffolding protein required for TGF-β activated kinase-1 (TAK1) mediated signalling. TAB1 is a specific protein that interacts with transforming growth factor β-activated kinase 1 (TAK1) (PMID: 32676538). TAB1\/TAK1 can activate nuclear factor κB (NF-κB) in high glucose (HG)-induced BMMs, regulating macrophage activation (PMID: 32296020, PMID: 23851980).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25576 Product name: Recombinant human MAP3K7IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-504 aa of BC050554 Sequence: TSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP Predict reactive species\nFull Name: mitogen-activated protein kinase kinase kinase 7 interacting protein 1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC050554\nGene Symbol: TAB1\nGene ID (NCBI): 10454\nRRID: AB_2880910\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15750\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869435023529,"sku":"27566-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27566-1-ap","provider":"Iright","version":"1.0","type":"link"}