{"product_id":"proteintech-27586-1-ap","title":"Proteintech, 27586-1-AP, TERT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TERT (27586-1-AP) by Proteintech is a Polyclonal antibody targeting TERT in WB, ELISA applications with reactivity to human, mouse, rat samples\n27586-1-AP targets TERT in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTelomerase reverse transcriptase (TERT) is a catalytic subunit of telomerase. TERT plays a key role in cancer formation, ensuring chromosomal stability by maintaining telomere length, and allowing cells to avert senescence. It constitutes a limiting factor for formation of the telomerase complex in cancer cells. TERT is one of two major components of the larger telomerase complex, which extends telomeres by adding specific short repetitive DNA sequences. Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. The calculated MW of TERT is 127 kDa, 27586-1-AP can detect a band around 100 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26270 Product name: Recombinant human TERT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 219-320 aa of NM_001193376 Sequence: MPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTP Predict reactive species\nFull Name: telomerase reverse transcriptase\nCalculated Molecular Weight: 127 kDa\nObserved Molecular Weight: ~100 kDa\nGenBank Accession Number: NM_001193376\nGene Symbol: TERT\nGene ID (NCBI): 7015\nRRID: AB_3085971\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14746\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869436432553,"sku":"27586-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27586-1-ap","provider":"Iright","version":"1.0","type":"link"}