{"product_id":"proteintech-27593-1-ap","title":"Proteintech, 27593-1-AP, SPINT1\/HAI-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPINT1\/HAI-1 (27593-1-AP) by Proteintech is a Polyclonal antibody targeting SPINT1\/HAI-1 in WB, IHC, ELISA applications with reactivity to human samples\n27593-1-AP targets SPINT1\/HAI-1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, MCF-7 cells\nPositive IHC detected in: human lung cancer tissue, human brown diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHepatocyte growth factor activator inhibitor type 1 (HAI-1) is also named as SPINT1 and Kunitz-type protease inhibitor 1. HAI-1 is critical to control matriptase proteolytic activity (PMID: 25310042). HAI-1 inhibits matriptase activity through forming complex with activated matriptase (PMID: 30370662). matriptase, HAI‐1 also binds to and inhibits a variety of serine proteases including of hepsin, plasmin, prostasin, TMPRSS13 and HAT. HAI-1 as a cell-autonomous tumor suppressor that negatively regulates the HGF pathway (PMID: 25925948). HAI-1 is inhibitor of HGFAC (PMID: 9045658). HAI-1 inhibits serine protease activity of ST14\/matriptase in vitro (PMID: 28710277). HAI-1 inhibits serine protease activity of TMPRSS13, via the BPTI\/Kunitz inhibitor 1 domain (PMID: 20977675). HAI-1 expression is reduced in many cancer types, which is implicated in the progression of cancer and is associated with a worse prognosis in cancer patients (PMID: 30370662).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26733 Product name: Recombinant human SPINT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 307-441 aa of BC004140 Sequence: SMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIP Predict reactive species\nFull Name: serine peptidase inhibitor, Kunitz type 1\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC004140\nGene Symbol: HAI-1\nGene ID (NCBI): 6692\nRRID: AB_2880918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43278\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887814889641,"sku":"27593-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27593-1-ap","provider":"Iright","version":"1.0","type":"link"}