{"product_id":"proteintech-27610-1-ap","title":"Proteintech, 27610-1-AP, FBXO11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO11 (27610-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO11 in WB, IP, ELISA applications with reactivity to Human samples\n27610-1-AP targets FBXO11 in WB, IP, CoIP, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, U2OS cells\nPositive IP detected in: LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24401 Product name: Recombinant human FBXO11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 858-927 aa of BC012728 Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN Predict reactive species\nFull Name: F-box protein 11\nCalculated Molecular Weight: 927 aa, 104 kDa\nObserved Molecular Weight: 94-104 kDa\nGenBank Accession Number: BC012728\nGene Symbol: FBXO11\nGene ID (NCBI): 80204\nRRID: AB_2880925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86XK2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869460713641,"sku":"27610-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27610-1-ap","provider":"Iright","version":"1.0","type":"link"}