{"product_id":"proteintech-27686-1-ap","title":"Proteintech, 27686-1-AP, RCOR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RCOR1 (27686-1-AP) by Proteintech is a Polyclonal antibody targeting RCOR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27686-1-AP targets RCOR1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cell, PC-12 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRCOR1, also named as REST corepressor 1, is a 485 amino acid protein, which belongs to the CoREST family. RCOR1 is a essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1\/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. The calculated molecular weight of RCOR1 is a 53 kDa, but the phosphorylated RCOR1 is about 60-65 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26770 Product name: Recombinant human RCOR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 245-310 aa of NM_015156 Sequence: MRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKP Predict reactive species\nFull Name: REST corepressor 1\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: NM_015156\nGene Symbol: RCOR1\nGene ID (NCBI): 23186\nRRID: AB_2880947\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKL0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973027497,"sku":"27686-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27686-1-ap","provider":"Iright","version":"1.0","type":"link"}