{"product_id":"proteintech-27688-1-ap","title":"Proteintech, 27688-1-AP, TP73 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TP73 (27688-1-AP) by Proteintech is a Polyclonal antibody targeting TP73 in WB, IHC, ELISA applications with reactivity to human samples\n27688-1-AP targets TP73 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, human placenta tissue\nPositive IHC detected in: human skin cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTP73 is a member of the TP53 family whose expression has been observed altered in most human cancers and associated with the prognosis. TP73 translates into a complex number of isoforms with both oncogenic and tumor-suppressor functions and presents a complex cross-talk with other members of the family (TP53 and TP63).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26686 Product name: Recombinant human TP73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001126240 Sequence: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYA Predict reactive species\nFull Name: tumor protein p73\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001126240\nGene Symbol: TP73\nGene ID (NCBI): 7161\nRRID: AB_3669616\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15350\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835762857,"sku":"27688-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27688-1-ap","provider":"Iright","version":"1.0","type":"link"}