{"product_id":"proteintech-27701-1-ap","title":"Proteintech, 27701-1-AP, ANKRD17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD17 (27701-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD17 in WB, IHC, ELISA applications with reactivity to human samples\n27701-1-AP targets ANKRD17 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKRD17 belongs to the family of ankyrin repeat-containing proteins, and contains two distinct arrays of ankyrin repeats in its amino-terminal region. It also contains a nuclear export signal, nuclear localization signal, and a cyclin-binding RXL motif. Localization of this protein to the nucleus has been shown experimentally, and interactions between this protein and cyclin-dependent kinase 2 have been observed.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26767 Product name: Recombinant human ANKRD17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1553-1684 aa of NM_001286771 Sequence: MGSHGKRNNTITTTSSKRKNRKNKITPENVQIIFDDPLPISYSQPEKVNGESKSSSTSESGDSDNMRISSCSDESSNSNSSRKSDNHSPAVVTTTVSSKKQPSVLVTFPKEERKSVSGKASIKLSETISEGTS Predict reactive species\nFull Name: ankyrin repeat domain 17\nCalculated Molecular Weight: 274 kDa\nObserved Molecular Weight: 270-300 kDa\nGenBank Accession Number: NM_001286771\nGene Symbol: ANKRD17\nGene ID (NCBI): 26057\nRRID: AB_3085987\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75179\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869635661993,"sku":"27701-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27701-1-ap","provider":"Iright","version":"1.0","type":"link"}