{"product_id":"proteintech-27708-1-ap","title":"Proteintech, 27708-1-AP, TMEM85 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM85 (27708-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM85 in WB, IHC, ELISA applications with reactivity to Human, Mouse, rat samples\n27708-1-AP targets TMEM85 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26785 Product name: Recombinant human TMEM85 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC002583 Sequence: MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCW Predict reactive species\nFull Name: transmembrane protein 85\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC002583\nGene Symbol: TMEM85\nGene ID (NCBI): 51234\nRRID: AB_2880950\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5J8M3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869504393385,"sku":"27708-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27708-1-ap","provider":"Iright","version":"1.0","type":"link"}