{"product_id":"proteintech-27717-1-ap","title":"Proteintech, 27717-1-AP, FAR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAR2 (27717-1-AP) by Proteintech is a Polyclonal antibody targeting FAR2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27717-1-AP targets FAR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human colon cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFatty acyl-CoA reductase 2 (FAR2), also known as MLSTD1, belongs to the fatty acyl-CoA reductase family. FAR2 catalyzes the reduction of saturated but not unsaturated C16 or C18 fatty acyl-CoA to fatty alcohols (PMID: 24009241). FAR2 may play a role in the production of ether lipids\/plasmalogens and wax monoesters which synthesis requires fatty alcohols as substrates. FAR2 has 2 isoforms with the molecular mass of 49 kDa and 59 kDa (Refer to Uniprot).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26819 Product name: Recombinant human FAR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-104 aa of BC022267 Sequence: LQQRVFQILDSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSC Predict reactive species\nFull Name: fatty acyl CoA reductase 2\nCalculated Molecular Weight: 515 aa, 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC022267\nGene Symbol: FAR2\nGene ID (NCBI): 55711\nRRID: AB_3669618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96K12\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887635189929,"sku":"27717-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27717-1-ap","provider":"Iright","version":"1.0","type":"link"}