{"product_id":"proteintech-27726-1-ap","title":"Proteintech, 27726-1-AP, ABCB4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCB4 (27726-1-AP) by Proteintech is a Polyclonal antibody targeting ABCB4 in WB, ELISA applications with reactivity to human samples\n27726-1-AP targets ABCB4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  L02 cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCB4, also known as MDR3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCB4 is expressed on the apical membrane of hepatocytes and functions to transport phosphatidylcholine (PC) from hepatocytes into the bile canaliculus (PMID: 16622704).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26840 Product name: Recombinant human ABCB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 628-706 aa of BC042531 Sequence: VNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKT Predict reactive species\nFull Name: ATP-binding cassette, sub-family B (MDR\/TAP), member 4\nCalculated Molecular Weight: 1286 aa, 142 kDa\nObserved Molecular Weight: 130-140 kDa\nGenBank Accession Number: BC042531\nGene Symbol: ABCB4\nGene ID (NCBI): 5244\nRRID: AB_2918128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869629698217,"sku":"27726-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27726-1-ap","provider":"Iright","version":"1.0","type":"link"}