{"product_id":"proteintech-27732-1-ap","title":"Proteintech, 27732-1-AP, ECHDC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ECHDC1 (27732-1-AP) by Proteintech is a Polyclonal antibody targeting ECHDC1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n27732-1-AP targets ECHDC1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, A549 cells\nPositive IHC detected in: mouse kidney tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26905 Product name: Recombinant human ECHDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-301 aa of BC003549 Sequence: PESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK Predict reactive species\nFull Name: enoyl Coenzyme A hydratase domain containing 1\nCalculated Molecular Weight: 307 aa, 34 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC003549\nGene Symbol: ECHDC1\nGene ID (NCBI): 55862\nRRID: AB_2880956\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NTX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887419347113,"sku":"27732-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27732-1-ap","provider":"Iright","version":"1.0","type":"link"}