{"product_id":"proteintech-27761-1-ap","title":"Proteintech, 27761-1-AP, SALL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SALL1 (27761-1-AP) by Proteintech is a Polyclonal antibody targeting SALL1 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n27761-1-AP targets SALL1 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissue, human placenta tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSALL1(Sal-like protein 1), also known as SAL1. It is located in the cytoplasm and nucleus. The protein is mainly expressed in the kidney. Transcriptional repressor involved in organogenesis. The protein plays an essential role in ureteric bud invasion during kidney development. The molecular weight of SALL1 is 140 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26766 Product name: Recombinant human SALL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 558-670 aa of NM_001127892 Sequence: MPLPPTLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPTASSSVLSSPAADCGPAGSATTFTNPLLPLMSEQF Predict reactive species\nFull Name: sal-like 1 (Drosophila)\nCalculated Molecular Weight: 140 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_001127892\nGene Symbol: SALL1\nGene ID (NCBI): 6299\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NSC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887791952041,"sku":"27761-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27761-1-ap","provider":"Iright","version":"1.0","type":"link"}