{"product_id":"proteintech-27769-1-ap","title":"Proteintech, 27769-1-AP, TLR9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLR9 (27769-1-AP) by Proteintech is a Polyclonal antibody targeting TLR9 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n27769-1-AP targets TLR9 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Jurkat cells,  Ramos cells,  SH-SY5Y cells,  mouse colon tissue,  rat colon tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLR9 is a member of the Toll-like receptor family which has been described in a wide-variety of animal species. TLR9 recognizes DNA motifs containing the dinucleotide CG (cytosine-guanine) where the C is unmethylated (CpG-containing DNA). TLR9 is expressed in a wide variety of cells such as B-cells, eosinophils, neutrophils, dendritic cells, macrophages, bronchial epithelial cells, and type-I and type-II lung cells, amongst others. Like all TLRs that recognize nucleic acids, TLR9 is confined to the endoplasmic reticulum and to endolysosomes. Western blot analysis revealed a 130 kDa band (entire form). 100 kDa fragment (soluble form) and a supplementary\n60~80 kDa band (cleaved fragment) (PMID: 24582318,18820679, 21604257).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25615 Product name: Recombinant human TLR9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 925-1032 aa of BC032713 Sequence: ASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE Predict reactive species\nFull Name: toll-like receptor 9\nCalculated Molecular Weight: 1032 aa, 116 kDa\nObserved Molecular Weight: 100-130 kDa, 60-80 kDa\nGenBank Accession Number: BC032713\nGene Symbol: TLR9\nGene ID (NCBI): 54106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NR96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887829110953,"sku":"27769-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27769-1-ap","provider":"Iright","version":"1.0","type":"link"}