{"product_id":"proteintech-27771-1-ap","title":"Proteintech, 27771-1-AP, HSPBAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPBAP1 (27771-1-AP) by Proteintech is a Polyclonal antibody targeting HSPBAP1 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n27771-1-AP targets HSPBAP1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells\nPositive IHC detected in: mouse kidney tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPBAP1, also named as Protein associated with small stress protein 1, is a widely expressed 488 amino acid protein. HSPBAP1 may play a role in regulating stress response in the living cell(PMID: 11978969). A chromosomal aberration involving HSPBAP1 has been found in a family with renal carcinoma (PMID:12939738). HSPBAP1 has multiple isoforms with MW 55, 50, 32 and 25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26808 Product name: Recombinant human HSPBAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 273-451 aa of BC011897 Sequence: IELEEDHLARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTDGEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASN Predict reactive species\nFull Name: HSPB (heat shock 27kDa) associated protein 1\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC011897\nGene Symbol: HSPBAP1\nGene ID (NCBI): 79663\nRRID: AB_2880968\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EW2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887672676521,"sku":"27771-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27771-1-ap","provider":"Iright","version":"1.0","type":"link"}