{"product_id":"proteintech-27787-1-ap","title":"Proteintech, 27787-1-AP, PNPLA7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PNPLA7 (27787-1-AP) by Proteintech is a Polyclonal antibody targeting PNPLA7 in IHC, ELISA applications with reactivity to human, mouse samples\n27787-1-AP targets PNPLA7 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPNPLA7 (Patatin-like phospholipase domain-containing protein 7), also termed NTE-related 1 (NTE-R1) or NRE, is a member of the PNPLAs family, which is conserved protein in mice, rats and humans. It serves key roles in triglyceride hydrolysis, energy metabolism, lipid droplet (LD), and in regulation of adipocyte differentiation. It is reported that PNPLA7 was down-regulated in HCC through hypermethylation of its promoter, which indicates that PNPLA7 may be a potential biomarker for HCC diagnosis (PMID: 16799181, 27347198).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27184 Product name: Recombinant human PNPLA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-468 aa of NM_001098537 Sequence: MVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCDSDHGGGRPAAAGPLLKRSHSVPAPSIRKQILEELEKPGAGDPDPSAPQGGPGSATSDLGMACDRARVFLHSDEHPGSSVASKSRKSVMVAEIPSTVSQHSESHTDETLASRKSDAIFRAAKKDLLTLMKLEDS Predict reactive species\nFull Name: patatin-like phospholipase domain containing 7\nCalculated Molecular Weight: 146 kDa\nGenBank Accession Number: NM_001098537\nGene Symbol: PNPLA7\nGene ID (NCBI): 375775\nRRID: AB_3669623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZV29\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887767343273,"sku":"27787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27787-1-ap","provider":"Iright","version":"1.0","type":"link"}