{"product_id":"proteintech-27796-1-ap","title":"Proteintech, 27796-1-AP, LRRC56 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRRC56 (27796-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC56 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n27796-1-AP targets LRRC56 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine-rich repeat (LRR)-containing gene 56 (LRRC56) was recently reported to be a homolog of the Outer Dynein Arm 8 gene (oda8), a gene necessary for the cytoplasmic maturation of the outer dynein arms (ODA) in the flagella of algae. LRRC56 is recruited during axoneme construction in an IFT-dependent manner and is required for the addition of dynein arms to the distal segment of the flagellum. Human LRRC56 encodes a 542 amino acid protein determined from transcriptomic studies and immunohistochemistry to be expressed in many organs, mostly in testis and pituitary gland.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22018 Product name: Recombinant human LRRC56 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-318 aa of BC035936 Sequence: MDLGWDRSRGPRRSTSSVRVRELSWQGLHNPCPQSKGPGSQRDRLGEQLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTGPPAPPRLSQDWLAVKEAIKKGNGLPPLDCPRGAPIRRLDPELSLPETQSRASRPWPFSLLVRGGPLPEGLLSEDLAPEDN Predict reactive species\nFull Name: leucine rich repeat containing 56\nCalculated Molecular Weight: 542 aa, 59 kDa\nGenBank Accession Number: BC035936\nGene Symbol: LRRC56\nGene ID (NCBI): 115399\nRRID: AB_3669624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYG6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887708229801,"sku":"27796-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27796-1-ap","provider":"Iright","version":"1.0","type":"link"}