{"product_id":"proteintech-27804-1-ap","title":"Proteintech, 27804-1-AP, RanBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RanBP1 (27804-1-AP) by Proteintech is a Polyclonal antibody targeting RanBP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n27804-1-AP targets RanBP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HEK-293 cells,  mouse brain tissue,  fetal human brain tissue,  HeLa cells,  RAW 264.7 cells,  NIH\/3T3 cells,  3T3-L1 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRanBP1 (Ran-binding protein 1) belongs to the RANBP1 family. RanBP1 plays a role in RAN-dependent nucleocytoplasmic transport. It alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus. And RanBP1 induces a conformation change in the complex formed by XPO1 and RAN that triggers the release of the nuclear export signal of cargo proteins (PMID:20485264). RanBP1 promotes dissociation of RAN from a complex with KPNA2 and CSE1L. It required for normal mitotic spindle assembly and normal progress through mitosis via its effect on RAN (PMID:17671426). Also, RanBP1 inhibits RCC1-dependent exchange of RAN-bound GDP by GTP (PMID:7882974, PMID:7616957).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25714 Product name: Recombinant human RANBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of Sequence: MLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ Predict reactive species\nFull Name: RAN binding protein 1\nObserved Molecular Weight: 28 kDa\nGene Symbol: RANBP1\nGene ID (NCBI): 5902\nRRID: AB_2880977\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43487\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869426471081,"sku":"27804-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-27804-1-ap","provider":"Iright","version":"1.0","type":"link"}